WH0004521M2

NUDT1 antibody from Sigma-Aldrich
MTH1
ELISA
Recommended by provider

Antibody data

Product number
WH0004521M2
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#WH0004521M2, RRID:AB_1842751
Product name
Monoclonal Anti-NUDT1 antibody produced in mouse
Provider product page
Sigma-Aldrich - WH0004521M2
Antibody type
Monoclonal
Antigen
NUDT1 (AAH14618, a.a. 1-180) full length recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
MSGISPQQMGEPEGSWSGKNPGTMGASRLYTLVLV
LQPQRVLLGMKKRGFGAGRWNGFGGKVQEGETIED
GARRELQEESGLTVDALHKVGQIVFEFVGEPELMD
VHVFCTDSIQGTPVESDEMRPCWFQLDQIPFKDMW
PDDSYWFPLLLQKKKFHGYFKFQGQDTILDYTLRE
VDTV* (without GST)
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -