Antibody data

Product number
H00004521-D01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00004521-D01, RRID:AB_10717364
Product name
NUDT1 MaxPab rabbit polyclonal antibody (D01)
Provider product page
Abnova Corporation - H00004521-D01
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against a full-length human NUDT1 protein.
Antigen sequence
MGASRLYTLVLVLQPQRVLLGMKKRGFGAGRWNGF
GGKVQEGETIEDGARRELQEESGLTVDALHKVGQI
VFEFVGEPELMDVHVFCTDSIQGTPVESDEMRPCW
FQLDQIPFKDMWPDDSYWFPLLLQKKKFHGYFKFQ
GQDTILDYTLREVDTV
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -