AV35363

KCNH6 antibody from MilliporeSigma / Merck KGaA
erg2, HERG2, Kv11.2
Immunohistochemistry
Recommended by provider

Antibody data

Product number
AV35363
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#AV35363, RRID:AB_1848237
Product name
Anti-KCNH6 (AB2) antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - AV35363
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human KCNH6 with an internal ID of P06601
Description
IgG fraction of antiserum
Reactivity
Human
Antigen sequence
QIPQFTLNFVEFNLEKHRSSSTTEIEIIAPHKVVE
RTQNVTEKVTQVLSL
Storage
-20C
Provider Type Product Number
- No reagents -