H00025833-A01

POU2F3 antibody from Abnova Corporation
Epoc-1, OCT11, PLA-1, Skn-1a
No application information provided.

Antibody data

Product number
H00025833-A01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00025833-A01, RRID:AB_462832
Product name
POU2F3 polyclonal antibody (A01)
Provider product page
Abnova Corporation - H00025833-A01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a partial recombinant POU2F3.
Antigen sequence
MVNLESMHTDIKMSGDVADSTDARSTLSQVEPGND
RNGLDFNRQIKTEDLSDSLQQTLSHRPCHLSQGPA
MMSGNQMSGLNASPCQDMASLHPLQQLVLVPGHLQ
SVSQ
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -