ABIN182598

POU2F3 antibody from antibodies-online
Epoc-1, OCT11, PLA-1, Skn-1a

Antibody data

Product number
ABIN182598
Provider
antibodies-online
Product name
anti-POU Class 2 Homeobox 3 (POU2F3) (N-Term) antibody
Provider product page
antibodies-online - ABIN182598
Antibody type
Polyclonal
Antigen
The immunogen for anti-POU2F3 antibody: synthetic peptide directed towards the N terminal of human POU2F3
Description
Affinity Purified
Reactivity
Human, Mouse, Rat, Canine, Zebrafish
Host
Rabbit
Antigen sequence
KMSGDVADSTDARSTLSQVEPGNDRKGLDFNRQIK
TEDLS DSLQQTLSHR
Epitope
N-Term
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -