Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA008445 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA008445, RRID:AB_1844336
- Product name
- Anti-YWHAE
- Antibody type
- Polyclonal
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDV
ELTVEERNLLSVAYKNVIGARRASWRIISSIEQKE- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references 14-3-3 fusion oncogenes in high-grade endometrial stromal sarcoma.
Lee CH, Ou WB, MariƱo-Enriquez A, Zhu M, Mayeda M, Wang Y, Guo X, Brunner AL, Amant F, French CA, West RB, McAlpine JN, Gilks CB, Yaffe MB, Prentice LM, McPherson A, Jones SJ, Marra MA, Shah SP, van de Rijn M, Huntsman DG, Dal Cin P, Debiec-Rychter M, Nucci MR, Fletcher JA
Proceedings of the National Academy of Sciences of the United States of America 2012 Jan 17;109(3):929-34
Proceedings of the National Academy of Sciences of the United States of America 2012 Jan 17;109(3):929-34
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex shows strong nuclear and cytoplasmic positivity in neuronal cells.
- Sample type
- HUMAN