HPA021581

NT5C antibody from Atlas Antibodies
cdN, DNT-1, DNT1, PN-I, UMPH2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA021581
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA021581, RRID:AB_1854663
Product name
Anti-NT5C
Provider product page
Atlas Antibodies - HPA021581
Antibody type
Polyclonal
Reactivity
Human, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
GALDAVREMNDLPDTQVFICTSPLLKYHHCVGEKY
RWVEQHLGPQFVERIILTRDKTVVL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -