WH0009775M1

EIF4A3 antibody from Sigma-Aldrich
DDX48, EIF4AIII, Fal1, KIAA0111
ELISA
Recommended by provider
Immunohistochemistry
Recommended by provider

Antibody data

Product number
WH0009775M1
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#WH0009775M1, RRID:AB_1841231
Product name
Monoclonal Anti-DDX48 antibody produced in mouse
Provider product page
Sigma-Aldrich - WH0009775M1
Antibody type
Monoclonal
Antigen
DDX48 (NP_055555, a.a. 312-412) partial recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
PQKERESIMKEFRSGASRVLISTDVWARGLDVPQV
SLIINYDLPNNRELYIHRIGRSGRYGRKGVAINFV
KNDDIRILRDIEQYYSTQIDEMPMNVADLI* (wi
thout GST)
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -