Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00054331-M03 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00054331-M03, RRID:AB_530061
- Product name
- GNG2 monoclonal antibody (M03), clone 4C8
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant GNG2.
- Antigen sequence
MASNNTASIAQARKLVEQLKMEANIDRIKVSKAAA
DLMAYCEAHAKEDPLLTPVPASENPFREKKFFCAI
L- Isotype
- IgG
- Antibody clone number
- 4C8
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of GNG2 expression in transfected 293T cell line by GNG2 monoclonal antibody (M03), clone 4C8.Lane 1: GNG2 transfected lysate(7.9 KDa).Lane 2: Non-transfected lysate.