PAB21055

ARMC9 antibody from Abnova Corporation
ARM, FLJ12584, KIAA1868, KU-MEL-1

Antibody data

Product number
PAB21055
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB21055, RRID:AB_10964242
Product name
ARMC9 polyclonal antibody
Provider product page
Abnova Corporation - PAB21055
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant ARMC9.
Antigen sequence
HESELLGLVKEYLDFAEFEDTLKTFSKECKIKGKP
LCKTVGGSFRDSKSLTIQKDLVAAFDNGDQKVFFD
LWEEHISSSIRD
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -