Explore
Validate
LearnH00006045-M01
antibody from Abnova Corporation
Targeting: RNF2
BAP-1, BAP1, DING, HIPI3, RING1B, RING2
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Western blot [3]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00006045-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00006045-M01, RRID:AB_606944
- Product name
- RNF2 monoclonal antibody (M01), clone 6C2
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant RNF2.
- Antigen sequence
PSNKRTKTSDDSGLELDNNNAAMAIDPVMDGASEI
ELVFRPHPTLMEKDDSAQTRYIKTSGNATVDHLSK
YLAVRLALEELRSKGESNQMNLDTASEKQ- Isotype
- IgG
- Antibody clone number
- 6C2
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Scmh1 has E3 ubiquitin ligase activity for geminin and histone H2A and regulates geminin stability directly or indirectly via transcriptional repression of Hoxa9 and Hoxb4.
Distinct histone modifications in stem cell lines and tissue lineages from the early mouse embryo.
Polycomb-group complex 1 acts as an E3 ubiquitin ligase for Geminin to sustain hematopoietic stem cell activity.
Yasunaga S, Ohtsubo M, Ohno Y, Saeki K, Kurogi T, Tanaka-Okamoto M, Ishizaki H, Shirai M, Mihara K, Brock HW, Miyoshi J, Takihara Y
Molecular and cellular biology 2013 Feb;33(4):644-60
Molecular and cellular biology 2013 Feb;33(4):644-60
Distinct histone modifications in stem cell lines and tissue lineages from the early mouse embryo.
Rugg-Gunn PJ, Cox BJ, Ralston A, Rossant J
Proceedings of the National Academy of Sciences of the United States of America 2010 Jun 15;107(24):10783-90
Proceedings of the National Academy of Sciences of the United States of America 2010 Jun 15;107(24):10783-90
Polycomb-group complex 1 acts as an E3 ubiquitin ligase for Geminin to sustain hematopoietic stem cell activity.
Ohtsubo M, Yasunaga S, Ohno Y, Tsumura M, Okada S, Ishikawa N, Shirao K, Kikuchi A, Nishitani H, Kobayashi M, Takihara Y
Proceedings of the National Academy of Sciences of the United States of America 2008 Jul 29;105(30):10396-401
Proceedings of the National Academy of Sciences of the United States of America 2008 Jul 29;105(30):10396-401
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- RNF2 monoclonal antibody (M01), clone 6C2 Western Blot analysis of RNF2 expression in NIH/3T3 ( Cat # L018V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- RNF2 monoclonal antibody (M01), clone 6C2. Western Blot analysis of RNF2 expression in Raw 264.7 ( Cat # L024V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of RNF2 expression in transfected 293T cell line by RNF2 monoclonal antibody (M01), clone 6C2.Lane 1: RNF2 transfected lysate(37.7 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged RNF2 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
