Antibody data

Product number
H00004656-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00004656-M01, RRID:AB_425561
Product name
MYOG monoclonal antibody (M01), clone 2B7
Provider product page
Abnova Corporation - H00004656-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full length recombinant MYOG.
Antigen sequence
MELYETSPYFYQEPRFYDGENYLPVHLQGFEPPGY
ERTELTLSPEAPGPLEDKGLGTPEHCPGQCLPWAC
KVCKRKSVSVDRRRAATLREKRRLKKVNEAFEALK
RSTLLNPNQRLPKVEILRSAIQYIERLQALLSSLN
QEERDLRYRGGGGPQPGVPSECSSHSASCSPEWGS
ALEFSANPGDHLLTADPTDAHNLHSLTSIVDSITV
EDVSVAFPDETMPN
Isotype
IgG
Antibody clone number
2B7
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -