ABIN406046

CLN8 antibody from antibodies-online
C8orf61, EPMR, FLJ39417, TLCD6

Antibody data

Product number
ABIN406046
Provider
antibodies-online
Product name
anti-Ceroid-Lipofuscinosis, Neuronal 8 (Epilepsy, Progressive with Mental Retardation) (CLN8) (N-Term) antibody
Provider product page
antibodies-online - ABIN406046
Antibody type
Polyclonal
Antigen
The immunogen for anti-CLN8 antibody: synthetic peptide directed towards the N terminal of human CLN8
Description
Affinity Purified
Reactivity
Human, Canine
Host
Rabbit
Antigen sequence
MNPASDGGTSESIFDLDYASWGIRSTLMVAGFVFY
LGVFV VCHQLSSSLN
Epitope
N-Term
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -