SAB2100448

CLN8 antibody from Sigma-Aldrich
C8orf61, EPMR, FLJ39417, TLCD6
No application information provided.

Antibody data

Product number
SAB2100448
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#SAB2100448, RRID:AB_10600565
Product name
Anti-CLN8 (ab1) antibody produced in rabbit
Provider product page
Sigma-Aldrich - SAB2100448
Antibody type
Polyclonal
Antigen
Peptide region of the protein sequence according to NP_061764.
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MNPASDGGTSESIFDLDYASWGIRSTLMVAGFVFY
LGVFVVCHQLSSSLN
Storage
-20C
Provider Type Product Number
- No reagents -