SAB2100418

CSGALNACT1 antibody from MilliporeSigma / Merck KGaA
ChGn, CSGalNAcT-1, FLJ11264
No application information provided.

Antibody data

Product number
SAB2100418
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#SAB2100418, RRID:AB_10602756
Product name
Anti-CHGN antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - SAB2100418
Antibody type
Polyclonal
Antigen
Peptide region of the protein sequence according to NP_060841.
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DELTPEQYKMCMQSKAMNEASHGQLGMLVFRHEIE
AHLRKQKQKTSSKKT
Storage
-20C
Provider Type Product Number
- No reagents -