HPA008848

antibody from Atlas Antibodies

Targeting: MCAM CD146, HEMCAM, MelCAM, METCAM, MUC18

Antibody data

Submit

Validation data

Product number: HPA008848 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA008848, RRID:AB_1078445
Product name: Anti-MCAM
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: LNYRLPSGNHMKESREVTVPVFYPTEKVWLEVEPV GMLKEGDRVEIRCLADGNPPPHFSISKQNPSTREA EEETTNDNGVLVLEPARKEHSGRYECQGLDLDTMI SLLSEPQELLVNYVSDVRVSPAAPERQEGSSLTLT CEAESSQDLE
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

MCAM protein structure - HPA008848 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human placenta and pancreas tissues using HPA008848 antibody. Corresponding MCAM RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon shows strong positivity in endothelial cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human placenta shows moderate cytoplasmic positivity in endothelial cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human prostate shows strong cytoplasmic positivity in smooth muscle cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pancreas shows weak cytoplasmic positivity in endothelial cells.
Sample type: HUMAN