Antibody data

Product number
H00010361-M03
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00010361-M03, RRID:AB_10963130
Product name
NPM2 monoclonal antibody (M03), clone 5E9
Provider product page
Abnova Corporation - H00010361-M03
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant NPM2.
Antigen sequence
MNLSSASSTEEKAVTTVLWGCELSQERRTWTFRPQ
LEGKQSCRLLLHTICLGEKAKEEMHRVEILPPANQ
EDKKMQPVTIASLQASVLPMVSMVGVQLSPPVTFQ
LRAGSGPVFLSGQERYEASDLTWEEEEEEEGEEEE
EEEEDDEDEDADISLEEQSPVKQVKRLVPQKQASV
AKKKKLEKEEEEIRASVRDKSPVKKAKATARAKKP
GFKK
Isotype
IgG
Antibody clone number
5E9
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.