ABIN406676

NPM2 antibody from antibodies-online
Western blot
Data presented on provider website

Antibody data

Product number
ABIN406676
Provider
antibodies-online
Product name
anti-Nucleophosmin/nucleoplasmin 2 (NPM2) (N-Term) antibody
Provider product page
antibodies-online - ABIN406676
Antibody type
Polyclonal
Antigen
The immunogen for anti-NPM2 antibody: synthetic peptide directed towards the N terminal of human NPM2
Description
Affinity Purified
Reactivity
Human
Host
Rabbit
Antigen sequence
LEGKQSCRLLLHTICLGEKAKEEMHRVEILPPANQ
EDKKM QPVTIASLQA
Epitope
N-Term
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.