SAB1400381

NPM2 antibody from MilliporeSigma / Merck KGaA
ELISA
Recommended by provider
Immunohistochemistry
Recommended by provider

Antibody data

Product number
SAB1400381
Provider
MilliporeSigma / Merck KGaA
Product name
Anti-NPM2 antibody produced in mouse
Provider product page
MilliporeSigma / Merck KGaA - SAB1400381
Antibody type
Polyclonal
Antigen
NPM2 (NP_877724.1, a.a. 1-214) full-length human protein.
Description
IgG fraction of antiserum
Reactivity
Human
Antigen sequence
MNLSSASSTEEKAVTTVLWGCELSQERRTWTFRPQ
LEGKQSCRLLLHTICLGEKAKEEMHRVEILPPANQ
EDKKMQPVTIASLQASVLPMVSMVGVQLSPPVTFQ
LRAGSGPVFLSGQERYEASDLTWEEEEEEEGEEEE
EEEEDDEDEDADISLEEQSPVKQVKRLVPQKQASV
AKKKKLEKEEEEIRASVRDKSPVKKAKATARAKKP
GFKK (without GST)
Storage
-20C