SAB2100019

ACAA2 antibody from MilliporeSigma / Merck KGaA
DSAEC
No application information provided.

Antibody data

Product number
SAB2100019
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#SAB2100019, RRID:AB_10611976
Product name
Anti-ACAA2 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - SAB2100019
Antibody type
Polyclonal
Antigen
Peptide region of the protein sequence according to NP_006102.
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MALLRGVFVVAAKRTPFGAYGGLLKDFTATDLSEF
AAKAALSAGKVSPET
Storage
-20C
Provider Type Product Number
- No reagents -