Antibody data
- Antibody Data
- Antigen structure
- References [4]
- Comments [0]
- Validations
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA003323 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA003323, RRID:AB_1080396
- Product name
- Anti-TXNRD2
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
CAGFLTGIGLDTTIMMRSIPLRGFDQQMSSMVIEH
MASHGTRFLRGCAPSRVRRLPDGQLQVTWEDSTTG
KEDTGTFDTVLWAIGRVPDTRSLNLEKAGVDTSPD
TQKILVDSREATSVPHIYAIGDVVEGRPELTPTAI
MAGRLLVQRLF- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Selective up-regulation of human selenoproteins in response to oxidative stress.
Monocarboxylate transporter 8 deficiency: altered thyroid morphology and persistent high triiodothyronine/thyroxine ratio after thyroidectomy
Human Protein Atlas of redox systems — What can be learnt?
Neuronal selenoprotein expression is required for interneuron development and prevents seizures and neurodegeneration
Touat-Hamici Z, Legrain Y, Bulteau AL, Chavatte L
The Journal of biological chemistry 2014 May 23;289(21):14750-61
The Journal of biological chemistry 2014 May 23;289(21):14750-61
Monocarboxylate transporter 8 deficiency: altered thyroid morphology and persistent high triiodothyronine/thyroxine ratio after thyroidectomy
Wirth E, Sheu S, Chiu-Ugalde J, Sapin R, Klein M, Mossbrugger I, Quintanilla-Martinez L, Hrabe de Angelis M, Krude H, Riebel T, Rothe K, Kohrle J, Schmid K, Schweizer U, Gruters A
European Journal of Endocrinology 2011 September;165(4):555-561
European Journal of Endocrinology 2011 September;165(4):555-561
Human Protein Atlas of redox systems — What can be learnt?
Dammeyer P, Arnér E
Biochimica et Biophysica Acta (BBA) - General Subjects 2011 January;1810(1):111-138
Biochimica et Biophysica Acta (BBA) - General Subjects 2011 January;1810(1):111-138
Neuronal selenoprotein expression is required for interneuron development and prevents seizures and neurodegeneration
Wirth E, Conrad M, Winterer J, Wozny C, Carlson B, Roth S, Schmitz D, Bornkamm G, Coppola V, Tessarollo L, Schomburg L, Kohrle J, Hatfield D, Schweizer U
The FASEB Journal 2010 February;24(3):844-852
The FASEB Journal 2010 February;24(3):844-852
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human stomach shows strong cytoplasmic positivity in glandular cells.
- Sample type
- HUMAN