Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00005860-M02 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00005860-M02, RRID:AB_464040
- Product name
- QDPR monoclonal antibody (M02), clone M1
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant QDPR.
- Antigen sequence
MAAAAAAGEARRVLVYGGRGALGSRCVQAFRARNW
WVASVDVVENEEASASIIVKMTDSFTEQADQVTAE
VGKLLGEEKVDAILCVAGGWAGGNAKSKSLFKNCD
LMWKQSIWTSTISSHLATKHLKEGGLLTLAGAKAA
LDGTPGMIGYGMAKGAVHQLCQSLAGKNSGMPPGA
AAIAVLPVTLDTPMNRKSMPEADFSSWTPLEFLVE
TFHDWITGKNRPSSGSLIQVVTTEGRTELTPAYF- Isotype
- IgG
- Antibody clone number
- M1
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Human myelin proteome and comparative analysis with mouse myelin.
Ishii A, Dutta R, Wark GM, Hwang SI, Han DK, Trapp BD, Pfeiffer SE, Bansal R
Proceedings of the National Academy of Sciences of the United States of America 2009 Aug 25;106(34):14605-10
Proceedings of the National Academy of Sciences of the United States of America 2009 Aug 25;106(34):14605-10
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- QDPR monoclonal antibody (M02), clone M1 Western Blot analysis of QDPR expression in HL-60 ( Cat # L014V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of QDPR expression in transfected 293T cell line by QDPR monoclonal antibody (M02), clone M1.Lane 1: QDPR transfected lysate(25.8 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged QDPR is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol