Antibody data

Product number
H00171483-B03
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00171483-B03, RRID:AB_1573875
Product name
FAM9B MaxPab mouse polyclonal antibody (B03)
Provider product page
Abnova Corporation - H00171483-B03
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human FAM9B protein.
Antigen sequence
MAAWGKKHAGKDPVRDECEERNRFTETREEDVTDE
HGEREPFAETDEHTGANTKKPEDTAEDLTAKRKRM
KMDKTCSKTKNKSKHALRKKQLKRQKRDYIHSLKL
LNVLEEYITDEQKEEEEEEGEEEELIRIFQEQQKK
WQQYRSVRRERLKEMKLLRDQFVKALEDFEDLCDR
VFSDEDSELDN
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -