WH0008905M1

AP1S2 antibody from MilliporeSigma / Merck KGaA
MRX59, MRXS5, PGS, SIGMA1B
ELISA
Recommended by provider

Antibody data

Product number
WH0008905M1
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#WH0008905M1, RRID:AB_1839688
Product name
Monoclonal Anti-AP1S2 antibody produced in mouse
Provider product page
MilliporeSigma / Merck KGaA - WH0008905M1
Antibody type
Monoclonal
Antigen
AP1S2 (AAH01117, a.a. 1-158) full length recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
MQFMLLFSRQGKLRLQKWYVPLSDKEKKKITRELV
QTVLARKPKMCSFLEWRDLKIVYKRYASLYFCCAI
EDQDNELITLEIIHRYVELLDKYFGSVCELDIIFN
FEKAYFILDEFLLGGEVQETSKKNVLKAIEQADLL
QEEAETPRSVLEEIGLT* (without GST)
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -