H00022918-M02
antibody from Abnova Corporation
Targeting: CD93
C1qR(P), C1QR1, C1qRP, CDw93, dJ737E23.1, ECSM3, MXRA4
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00022918-M02 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00022918-M02, RRID:AB_518710
- Product name
- CD93 monoclonal antibody (M02), clone 3D12
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant CD93.
- Antigen sequence
GTACYTAHSGKLSAAEAQNHCNQNGGNLATVKSKE
EAQHVQRVLAQLLRREAALTARMSKFWIGLQREKG
KCLDPSLPLKGFSWVGGGEDTPYSNWHKELRNSCI
SKR- Isotype
- IgG
- Antibody clone number
- 3D12
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of CD93 expression in transfected 293T cell line by CD93 monoclonal antibody (M02), clone 3D12.Lane 1: CD93 transfected lysate (Predicted MW: 71.72 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged CD93 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol