HPA012368
antibody from Atlas Antibodies
Targeting: CD93
C1qR(P), C1QR1, C1qRP, CDw93, dJ737E23.1, ECSM3, MXRA4
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [9]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA012368 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA012368, RRID:AB_1846341
- Product name
- Anti-CD93
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
HVQRVLAQLLRREAALTARMSKFWIGLQREKGKCL
DPSLPLKGFSWVGGGEDTPYSNWHKELRNSCISKR
CVSLLLDLSQPLLPSRLPKWSEGPCGSPGSPGSNI
EGFVCKFS- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Western blot analysis in control (vector only transfected HEK293T lysate) and cD93 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY415997).
- Sample type
- HUMAN
Enhanced validation
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human lung and skeletal muscle tissues using HPA012368 antibody. Corresponding CD93 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Independent antibody validation
- Main image
- Experimental details
- Immunohistochemical staining of human colon, kidney, lung and skeletal muscle using Anti-CD93 antibody HPA012368 (A) shows similar protein distribution across tissues to independent antibody HPA009300 (B).
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human spleen shows distinct positivity in endothelial cells and in a subset of red pulp cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human lung shows high expression.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human pancreas shows low expression as expected.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human skeletal muscle shows moderate membranous positivity in endothelial cells, myocytes are negative.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human lung shows strong membranous positivity in endothelial cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human colon shows strong membranous positivity in endothelial cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney shows strong membranous positivity in endothelial cells.
- Sample type
- HUMAN