AV51203

OLFM4 antibody from MilliporeSigma / Merck KGaA
GC1, GW112, OlfD
No application information provided.

Antibody data

Product number
AV51203
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#AV51203, RRID:AB_1854789
Product name
Anti-OLFM4 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - AV51203
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human OLFM4 with an internal ID of P28071
Description
IgG fraction of antiserum
Reactivity
Human
Antigen sequence
NAFMVCGVLYATRTMNTRTEEIFYYYDTNTGKEGK
LDIVMHKMQEKVQSI
Storage
-20C
Provider Type Product Number
- No reagents -