Antibody data

Product number
H00004682-M03
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00004682-M03, RRID:AB_1237803
Product name
NUBP1 monoclonal antibody (M03), clone 2B11
Provider product page
Abnova Corporation - H00004682-M03
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant NUBP1.
Antigen sequence
PIIGVVENMSGFICPKCKKESQIFPPTTGGAELMC
QDLEVPLLGRVPLDPLIGKNCDKGQSFFIDAPDSP
ATLAYRSIIQRIQEFCNLHQSKEENLISS
Isotype
IgG
Antibody clone number
2B11
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -