Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Immunohistochemistry [5]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA011220 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA011220, RRID:AB_1855041
- Product name
- Anti-PCDH10
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
KEKKLNIYTCLASDCCLCCCCCGGGGSTCCGRQAR
ARKKKLSKSDIMLVQSSNVPSNPAQVPIEESGGFG
SHHHNQNYCYQVCLTPESAKTDLMFLKPCSPSRST
DTEHNPCGAIVTGYTDQQPDIISNGSILSNETKHQ
RA- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Identification of a novel set of genes reflecting different in vivo invasive patterns of human GBM cells.
Monticone M, Daga A, Candiani S, Romeo F, Mirisola V, Viaggi S, Melloni I, Pedemonte S, Zona G, Giaretti W, Pfeffer U, Castagnola P
BMC cancer 2012 Aug 17;12:358
BMC cancer 2012 Aug 17;12:358
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in glial cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neuropil.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human adrenal gland shows moderate to strong cytoplasmic positivity in glandular cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human lymph node shows moderate to strong cytoplasmic positivity in non - germinal center cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected.
- Sample type
- HUMAN