HPA034786

antibody from Atlas Antibodies

Targeting: OBI1 C13orf7, FLJ13449, RNF219

Antibody data

Submit

Validation data

Product number: HPA034786 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA034786, RRID:AB_2674331
Product name: Anti-RNF219
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: RSENEKKSECFSSPKTGFWDCCSTSYAQNLDFESS EGNTIANSVGEISSKLSEKSGLCLSKRLNSIRSFE MNRTRTSSEASMDAAYLDKISELDSMMS
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

OBI1 protein structure - HPA034786 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human testis and pancreas tissues using Anti-RNF219 antibody. Corresponding RNF219 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, kidney, lymph node and testis using Anti-RNF219 antibody HPA034786 (A) shows similar protein distribution across tissues to independent antibody HPA034785 (B).
Antibody #2 product nr: HPA034785
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pancreas shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney using Anti-RNF219 antibody HPA034786.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex using Anti-RNF219 antibody HPA034786.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node using Anti-RNF219 antibody HPA034786.
Sample type: HUMAN