Antibody data

Product number
H00002589-M10
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00002589-M10, RRID:AB_1575067
Product name
GALNT1 monoclonal antibody (M10), clone 3C10
Provider product page
Abnova Corporation - H00002589-M10
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant GALNT1.
Antigen sequence
LPAGDVLEPVQKPHEGPGEMGKPVVIPKEDQEKMK
EMFKINQFNLMASEMIALNRSLPDVRLEGCKTKVY
PDNLPTTSVVIV
Isotype
IgG
Antibody clone number
3C10
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -