H00055284-M01

UBE2W antibody from Abnova Corporation
FLJ11011, UBC-16

Antibody data

Product number
H00055284-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00055284-M01, RRID:AB_530043
Product name
UBE2W monoclonal antibody (M01), clone 7G4
Provider product page
Abnova Corporation - H00055284-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant UBE2W.
Antigen sequence
KRLQKELLALQNDPPPGMTLNEKSVQNSITQWIVD
MEGAPGTLYEGEKFQLLFKFSSRYPFDSPQVMFTG
ENIPVHPHVYSNGHICLSILTEDWSP
Isotype
IgG
Antibody clone number
7G4
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -