Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00004799-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00004799-M01, RRID:AB_489770
- Product name
- NFX1 monoclonal antibody (M01), clone 1D12
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant NFX1.
- Antigen sequence
KFSDSLKEDARKDLKFVSDVEKEMETLVEAVNKGK
NSKKSHSFPPMNRDHRRIIHDLAQVYGLESVSYDS
EPKRNVVVTAIRGKSVCPPTTLTGVLEREM- Isotype
- IgG
- Antibody clone number
- 1D12
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- NFX1 monoclonal antibody (M01), clone 1D12 Western Blot analysis of NFX1 expression in Hela S3 NE ( Cat # L013V3 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged NFX1 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to NFX1 on HeLa cell. [antibody concentration 30 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol