SAB2100392

CDS1 antibody from Sigma-Aldrich
No application information provided.

Antibody data

Product number
SAB2100392
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#SAB2100392, RRID:AB_10605465
Product name
Anti-CDS1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - SAB2100392
Antibody type
Polyclonal
Antigen
Peptide region of the protein sequence according to NP_001254.
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VVFGFIAAYVLSKYQYFVCPVEYRSDVNSFVTECE
PSELFQLQTYSLPPF
Storage
-20C
Provider Type Product Number
- No reagents -