WH0025793M1

FBXO7 antibody from MilliporeSigma / Merck KGaA
Fbx, FBX7, PARK15
ELISA
Recommended by provider

Antibody data

Product number
WH0025793M1
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#WH0025793M1, RRID:AB_1841585
Product name
Monoclonal Anti-FBXO7 antibody produced in mouse
Provider product page
MilliporeSigma / Merck KGaA - WH0025793M1
Antibody type
Monoclonal
Antigen
FBXO7 (NP_036311, a.a. 357-456) partial recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
AVCRDLFTASNDPLLWRFLYLRDFRDNTVRVQDTD
WKELYRKRHIQRKESPKGRFVMLLPSSTHTIPFYP
NPLHPRPFPSSRLPPGIIGGEYDQRPTLP* (wit
hout GST)
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -