Antibody data

Product number
H00053904-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00053904-M01, RRID:AB_534945
Product name
MYO3A monoclonal antibody (M01), clone 8D12
Provider product page
Abnova Corporation - H00053904-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant MYO3A.
Antigen sequence
HEEINNIKKKDNKDSKATSEREACGLAIFSKQISK
LSEEYFILQKKLNEMILSQQLKSLYLGVSHHKPIN
RRVSSQQCLSGVCKGEEPKIL
Isotype
IgG
Antibody clone number
8D12
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -