Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00003202-M06 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00003202-M06, RRID:AB_581850
- Product name
- HOXA5 monoclonal antibody (M06), clone 3C2
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant HOXA5.
- Antigen sequence
PAQPQIYPWMRKLHISHDNIGGPEGKRARTAYTRY
QTLELEKEFHFNRYLTRRRRIEIAHALCLSERQIK
IWFQNRRMKWKKDNKLKSMSMAAAGGAFRP- Isotype
- IgG
- Antibody clone number
- 3C2
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Evaluating Serum Markers for Hormone Receptor-Negative Breast Cancer.
Schummer M, Thorpe J, Giraldez MD, Bergan L, Tewari M, Urban N
PloS one 2015;10(11):e0142911
PloS one 2015;10(11):e0142911
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged HOXA5 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to HOXA5 on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol