Antibody data

Product number
H00003202-M02
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00003202-M02, RRID:AB_714736
Product name
HOXA5 monoclonal antibody (M02), clone 3E8
Provider product page
Abnova Corporation - H00003202-M02
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant HOXA5.
Antigen sequence
PAQPQIYPWMRKLHISHDNIGGPEGKRARTAYTRY
QTLELEKEFHFNRYLTRRRRIEIAHALCLSERQIK
IWFQNRRMKWKKDNKLKSMSMAAAGGAFRP
Isotype
IgG
Antibody clone number
3E8
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -