WH0009240M1

PNMA1 antibody from MilliporeSigma / Merck KGaA
MA1
ELISA
Recommended by provider
Immunohistochemistry
Recommended by provider

Antibody data

Product number
WH0009240M1
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#WH0009240M1, RRID:AB_1843052
Product name
Monoclonal Anti-PNMA1 antibody produced in mouse
Provider product page
MilliporeSigma / Merck KGaA - WH0009240M1
Antibody type
Monoclonal
Antigen
PNMA1 (NP_006020, a.a. 62-161) partial recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
purified immunoglobulin
Reactivity
Human, Mouse
Antigen sequence
KAALLELTGAVDYAAIPREMPGKGGVWKVLFKPPT
SDAEFLERLHLFLAREGWTVQDVARVLGFQNPTPT
PGPEMPAEMLNYILDNVIQPLVESIWYKR* (wit
hout GST)
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -