SAB1401575

CLSTN1 antibody from MilliporeSigma / Merck KGaA
CDHR12, CSTN1, KIAA0911
No application information provided.

Antibody data

Product number
SAB1401575
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#SAB1401575, RRID:AB_10609794
Product name
Anti-CLSTN1 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - SAB1401575
Antibody type
Polyclonal
Antigen
CLSTN1 (AAH33902.1, 1 a.a. ~ 971 a.a) full-length human protein.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
MLRRPAPALAPAARLLLAGLLCGGGVWAARVNKHK
PWLEPTYHGIVTENDNTVLLDPPLIALDKDAPLRF
AGEICGFKIHGQNVPFDAVVVDKSTGEGVIRSKEK
LDCELQKDYSFTIQAYDCGKGPDGTNVKKSHKATV
HIQVNDVNEYAPVFKEKSYKATVIEGKQYDSILRV
EAVDADCSPQFSQICSYEIITPDVPFTVDKDGYIK
NTEKLNYGKEHQYKLTVTAYDCGKKRATEDVLVKI
SIKPTCTPGW
Storage
-20C
Provider Type Product Number
- No reagents -