AV32185

NT5C3A antibody from MilliporeSigma / Merck KGaA
cN-III, hUMP1, NT5C3, p36, P5'N-1, PN-I, POMP, PSN1, UMPH, UMPH1
No application information provided.

Antibody data

Product number
AV32185
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#AV32185, RRID:AB_1854669
Product name
Anti-NT5C3 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - AV32185
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human NT5C3 with an internal ID of P03158.
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VYHPNVKVVSNFMDFDETGVLKGFKGELIHVFNKH
DGALRNTEYFNQLKD
Storage
-20C
Provider Type Product Number
- No reagents -