HPA029058

NT5C3A antibody from MilliporeSigma / Merck KGaA
cN-III, hUMP1, NT5C3, p36, P5'N-1, PN-I, POMP, PSN1, UMPH, UMPH1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA029058
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA029058, RRID:AB_10601380
Product name
Anti-NT5C3 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA029058
Antibody type
Polyclonal
Antigen
5'-nucleotidase, cytosolic III recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RIKNPTRVEEIICGLIKGGAAKLQIITDFDMTLSR
FSYKGKRCPTCHNIIDNCKLVTDECRKKLLQLKEK
YYAIEVDPVLTVEEKYPYMVEWYTKSHGLLVQQAL
PKAKLKEIVAESDVMLKEGY
Storage
-20C
Provider Type Product Number
- No reagents -