HPA029274

antibody from Atlas Antibodies

Targeting: CFAP74 C1orf222, FLJ45476, KIAA1751

Antibody data

Submit

Validation data

Product number: HPA029274 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA029274, RRID:AB_10601997
Product name: Anti-CFAP74
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: LDVPVESLTAIPVFDPRHREASSRPGPLSPEAEEL RPILVTLDYIQFDTDTPAPPATRELQVGCIRTTQP SPKK
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

CFAP74 protein structure - HPA029274 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human fallopian tube and prostate tissues using Anti-CFAP74 antibody. Corresponding CFAP74 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, colon, fallopian tube and testis using Anti-CFAP74 antibody HPA029274 (A) shows similar protein distribution across tissues to independent antibody HPA028521 (B).
Antibody #2 product nr: HPA028521
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human fallopian tube shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human prostate shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex using Anti-CFAP74 antibody HPA029274.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon using Anti-CFAP74 antibody HPA029274.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis using Anti-CFAP74 antibody HPA029274.
Sample type: HUMAN