Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00051268-M10 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00051268-M10, RRID:AB_1137372
- Product name
- PIPOX monoclonal antibody (M10), clone 3D1
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant PIPOX.
- Antigen sequence
IGDVQILSSFVRDHLPDLKPEPAVIESCMYTNTPD
EQFILDRHPKYDNIVIGAGFSGHGFKLAPVVGKIL
YELSMKLTPSYDLAPFRISRFPG- Isotype
- IgG
- Antibody clone number
- 3D1
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references The role of sarcosine metabolism in prostate cancer progression.
Khan AP, Rajendiran TM, Ateeq B, Asangani IA, Athanikar JN, Yocum AK, Mehra R, Siddiqui J, Palapattu G, Wei JT, Michailidis G, Sreekumar A, Chinnaiyan AM
Neoplasia (New York, N.Y.) 2013 May;15(5):491-501
Neoplasia (New York, N.Y.) 2013 May;15(5):491-501
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of PIPOX expression in transfected 293T cell line by PIPOX monoclonal antibody (M10), clone 3D1.Lane 1: PIPOX transfected lysate(44.1 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to PIPOX on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoprecipitation of PIPOX transfected lysate using anti-PIPOX monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with PIPOX MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol
