SAB1401257

NDUFB1 antibody from MilliporeSigma / Merck KGaA
CI-MNLL, MNLL
No application information provided.

Antibody data

Product number
SAB1401257
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#SAB1401257, RRID:AB_10607888
Product name
Anti-NDUFB1 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - SAB1401257
Antibody type
Polyclonal
Antigen
NDUFB1 (NP_004536.2, 1 a.a. ~ 105 a.a) full-length human protein.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
MICWRHPSAPCGRGEWQVPRSQLPLARVEFPVALG
LGVAVGAEAAAIMVNLLQIVRDHWVHVLVPMGFVI
GCYLDRKSDERLTAFRNKSMLFKRELQPSEEVTWK
Storage
-20C
Provider Type Product Number
- No reagents -