WH0245973M1

ATP6V1C2 antibody from MilliporeSigma / Merck KGaA
ATP6C2, VMA5
ELISA
Recommended by provider

Antibody data

Product number
WH0245973M1
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#WH0245973M1, RRID:AB_1840017
Product name
Monoclonal Anti-ATP6V1C2 antibody produced in mouse
Provider product page
MilliporeSigma / Merck KGaA - WH0245973M1
Antibody type
Monoclonal
Antigen
ATP6V1C2 (NP_653184, a.a. 188-254) partial recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
VPKPNYSQWQKTYESLSDMVVPRSTKLITEDKEGG
LFTVTLFRKVIEDFKTKAKENKFTVREFYYD* (w
ithout GST)
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -