Antibody data

Product number
H00245973-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00245973-M01, RRID:AB_490087
Product name
ATP6V1C2 monoclonal antibody (M01), clone 3D5
Provider product page
Abnova Corporation - H00245973-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant ATP6V1C2.
Antigen sequence
VPKPNYSQWQKTYESLSDMVVPRSTKLITEDKEGG
LFTVTLFRKVIEDFKTKAKENKFTVREFYYD
Isotype
IgG
Antibody clone number
3D5
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -