H00002395-M01

FXN antibody from Abnova Corporation
CyaY, FA, FARR, FRDA, X25

Antibody data

Product number
H00002395-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00002395-M01, RRID:AB_1111850
Product name
FXN monoclonal antibody (M01), clone 1D9
Provider product page
Abnova Corporation - H00002395-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant FXN.
Antigen sequence
DETTYERLAEETLDSLAEFFEDLADKPYTFEDYDV
SFGSGVLTVKLGGDLGTYVINKQTPNKQIWLSSPS
SGPKRYDWTGKNWVYSHDGVSLHELLAAELTKALK
TKLDL
Isotype
IgG
Antibody clone number
1D9
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -