WH0001016M1

CDH18 antibody from Sigma-Aldrich
CDH14, EY-CADHERIN
ELISA
Recommended by provider
Immunohistochemistry
Recommended by provider

Antibody data

Product number
WH0001016M1
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#WH0001016M1, RRID:AB_1840421
Product name
Monoclonal Anti-CDH18 antibody produced in mouse
Provider product page
Sigma-Aldrich - WH0001016M1
Antibody type
Monoclonal
Antigen
CDH18 (NP_004925, a.a. 467-577) partial recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
DLLSHVTVGIRVLDVNDNPPELAREYDIIVCENSK
PGQVIHTISATDKDDFANGPRFNFFLDERLPVNPN
FTLKDNEDNTASILTRRRRFSRTVQDVYYLPIMIS
DGGIP* (without GST)
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -