Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00003221-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00003221-M01, RRID:AB_606405
- Product name
- HOXC4 monoclonal antibody (M01), clone 1E9
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant HOXC4.
- Antigen sequence
RTAYTRQQVLELEKEFHYNRYLTRRRRIEIAHSLC
LSERQIKIWFQNRRMKWKKDHRLPNTKVRSAPPAG
AAPSTLSAATPGTSEDHSQSATPPEQQRAEDITRL- Isotype
- IgG
- Antibody clone number
- 1E9
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- HOXC4 monoclonal antibody (M01), clone 1E9 Western Blot analysis of HOXC4 expression in A-549 ( Cat # L025V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of HOXC4 expression in transfected 293T cell line by HOXC4 monoclonal antibody (M01), clone 1E9.Lane 1: HOXC4 transfected lysate(29.8 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged HOXC4 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol